Dataset for protein Unclassified of organism Amphilophus citrinellus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3Q0T8Z8_unc070L-01 Putative 070L protein OS=[Eukaryota] Amphilophus citrinellus (length=242 residues).
MYAVQGYFVLCGKKYCLICACQEGEQHPAACTDMTCKVMDIVNMQLYIPPEPPLLFMGDTKHLLNQGLELDGTSILQLDP
DFTVLGDNANMVHLYNTIDTHQCFTCTLSLKDFVQGDTFLGEHIYHVYNNGIELLDKHRSTYEAMITQLPEVDEQLIIRL
ASFLFDDGIVNWGRIVSFIAFAAVASQMSHLCKEDWYVTGIGRAVANYLTERHLDWLVANGSWVREGVCVTVSVIILLHK
VT
© 1998-2019