Dataset for protein 097R of organism Ambystoma tigrinum virus

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A0U2QBA9_097R-01 097R protein OS=[Viruses] Ambystoma tigrinum virus GN=097R (length=137 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNMACAHLYTMLWEGINLEEVHASFLGDGVVNWGRVAAFMHICRYTVRTFPS
SMDRTEVALTKFIQDPKIYKHLREWTDRLGTVGVIGRCLKWLGAGVITGVVLSLLFS
>gnl|bcl2dbpro|A0A0U2QHX4_097R-01 097R protein OS=[Viruses] Ambystoma tigrinum virus GN=097R (length=137 residues).
MDVRQFLLDCEAPEEMVALRAAADAVGVDNMACAHLYTMLWEGVNLEEVHASFLGDGVVNWGRVAAFMHICRYTVRTFPS
SMDRTEVALTKFIQDPKIYKHLREWTDRLGTVGVIGRCLKWLGAGVITGVVLSLLFS
>gnl|bcl2dbpro|A0A0U2R7T3_097R-01 097R protein OS=[Viruses] Ambystoma tigrinum virus GN=097R (length=137 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNMACAHLYTMLWEGVNLEEVHASFLGDGVVNWGRVAAFMHICRYTVRTFPS
SMDRTEVALTKFIQDPKIYKHLREWTDRLGTVGVIGRCLKWLGAGVITGVVLSLLFS
© 1998-2018