Dataset for protein 097R of organism Ambystoma tigrinum stebbensi virus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|Q6YH32_097R-01 097R protein OS=[Viruses] Ambystoma tigrinum stebbensi virus GN=097R (length=137 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNMACAHLYTMLWEGVNLEEVHASFLGDGVVNWGRVAAFMHICRYTVRTFPS
SMDRTEVALTKFIQDPKIYKHLREWTDRLGTVGVIGRCLKWLGAGVITGVVLSLLFS
© 1998-2018