Dataset for protein vNR13 of organism all

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|Q90343_vNR13-01 vNR13 protein OS=[Eukaryota] Coturnix japonica GN=vNR13 (length=177 residues).
MPGSLKEETALLLEDYFQHRAGGAALPPSATAAELRRAAAELERRERPFFRSCAPLARAEPREAAALLRKVAAQLETDGG
LNWGRLLALVVFAGTLAAALAESACEEGPSRLAAALTAYLAEEQGEWMEEHGGWDGFCRFFGRHGSQPADQNSTLSNAIM
AAAGFGIAGLAFLLVVR
>gnl|bcl2dbpro|H3ALX7_vNR13-01 vNR13 protein OS=[Eukaryota] Latimeria chalumnae GN=vNR13 (length=178 residues).
MCDSLKEETRLLANDFIQFCLGSGRTAPNPAARVLRRVTAELERQNQALFDSFQGNCGPEAELGSVLKRVAEQLEAEGGL
NWGRVVSLFAFAGCLAKGVQRAQNEECAMGACCGKLAEALVNYLAKERGDWLEENGGWDGFYKFFERSDHYQESTVRNAL
MAAAGFGIAGLAFLLAVR
>gnl|bcl2dbpro|Q9E1F2_vNR13-01 vNR13 protein OS=[Viruses] Meleagrid herpesvirus 1 GN=vNR13 (length=179 residues).
MADSLKEETALLLEDYFQHCCGKEGPPPSPTAAELRRAAAELERRERPFFRSCAPLASGGTQAALSALQSVVSELNSGSG
FNWGRCLATIVLGGSLATALYENGCEEGPSRLAAALAAYLAEEQGEWLREHGGWDGFCRFFARFGPGLGEASQTFPLGLI
VAAAGIGITVLIVVWQFQS
>gnl|bcl2dbpro|Q9E1F2_vNR13-02 vNR13 protein OS=[Viruses] Meleagrid herpesvirus 1 GN=vNR13 (length=162 residues).
MADSLKEETALLLEDYFQHCCGKEGPPPSPTAAELRRAAAELERRERPFFRSCAPLASGGTQAALSALQSVVSELNSGSG
FNWGRCLATIVLGGSLATALYENGCEEGPSRLAAALAAYLAEEQGEWLREHGGWVSTARAGMSGSFGSPVSARSEEHRAR
RW
© 1998-2018