Dataset for protein v-Bcl-2 of organism all

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|Q1XBS6_VBCL2-01 V-BCL-2 protein OS=[Viruses] Bovine herpesvirus 4 GN=V-BCL-2 (length=226 residues).
MSLFFVVWYWVNYITKVCSGEVYIPSVLKFQYHSDTEHEPYSNLCENLITMAEQDMDEVVSTIRRLLVECGMGLEEYLDH
PVTAPIKVAVQDVIRTKQDIFSNFLTNINSVEDLETLGHAITTLNDYPSPNMGRVVCGIAFSVYVVQTVCKRKPLLVRCC
LDIFTRATVQALNVNWFLQEGGWPALASFCKVVNSPSPRSRWLFPMLAISGLVLTVGVARNMVHFT
>gnl|bcl2dbpro|Q1XBS7_VBCL2-01 V-BCL-2 protein OS=[Viruses] Bovine herpesvirus 4 GN=V-BCL-2 (length=226 residues).
MSLFFVVWYWVNYITKVCSGEVYIPSVLKFQYHSDTEHEPYSNLCENLITMAEQDMDEVVSTIRRLLVECGMGLEEYLEH
PVTAPIKVAVQDVIRTKQDIFSNFLTNINSVEDLETLGHAITTLNDYPSPNMGRVVCGIAFSVYVVQTVCKRKPLLVRCC
LDIFTRATVQALNVNWFLQEGGWPALASFCKVVNSPSPRSRWLFPMLAISGLVLTVGVARNMVHFT
>gnl|bcl2dbpro|Q1XBS8_VBCL2-01 V-BCL-2 protein OS=[Viruses] Bovine herpesvirus 4 GN=V-BCL-2 (length=226 residues).
MSLFFIVWYWVNYITKVCSGEVYIPSVLKFQYHSDTEHEPYSNLCENLITMAEQDMDEVVSTIRRLLVECGMGLEEYLDH
PVTAPIKVAVQDVIRTKQDIFSNFLTNINSVEDLETLGHAITTLNDYPSPNMGRVVCGIAFSVYVVQTVCKRKPLLVRCC
LDIFTRATVQALNVNWFLQEGGWPALASFCKVVNSPSPRSRWLFPMLAISGLVLTVGVARNMVHFT
>gnl|bcl2dbpro|Q99D15_VBCL2-01 V-BCL-2 protein OS=[Viruses] Bovine herpesvirus 4 GN=V-BCL-2 (length=226 residues).
MSLFFVVWYWVNYITKVCFGEVYIPSVLKFQYHSDTEHEPYSNLCKNLITMAEQDMDEVVSTIRRLLVECGMGLEEYLEH
PVTAPIKVAVQDVIRTKQDIFSNFLTNINSVEDLETLGHAITTLNDYPSPNMGRVVCGIAFSVYVVQTVCKRKPLLVRCC
LDIFTRATVQALNVNWFLQEGGWPALASFCKVVNSPSPRSRWLFPMFAISGLVLTVGVARNMVHFT
>gnl|bcl2dbpro|Q9WH78_VBCL2-01 V-BCL-2 protein OS=[Viruses] Bovine herpesvirus 4 GN=V-BCL-2 (length=226 residues).
MSLFFVVWYWVNYITKVCSGEVYIPSVLKFQYHSDTEHEPYSNLCKNLITMAEQDMDEVVSTIRRLLVECGMGLEEYLEH
PVTAPIKVAVQDVIRTKQDIFSNFLTNINSVEDLETLGHAITTLNDYPSPNMGRVVCGIAFSVYVVQTVCKRKPLLVRCC
LDIFTRATVQALNVNWFLQEGGWPALASFCKVVNSPSPRSRWLFPMFAISGLVLTVGVARNMVHFT
© 1998-2018