Dataset for protein ORF16 of organism all

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|P90504_ORF16-01 ORF16 protein OS=[Viruses] Human herpesvirus 8 type M GN=ORF16 (length=175 residues).
MDEDVLPGEVLAIEGIFMACGLNEPEYLYHPLLSPIKLYITGLMRDKESLFEAMLANVRFHSTTGINQLGLSMLQVSGDG
NMNWGRALAILTFGSFVAQKLSNEPHLRDFALAVLPVYAYEAIGPQWFRARGGWRGLKAYCTQVLTRRRGRRMTALLGSI
ALLATILAAVAMSRR
>gnl|bcl2dbpro|F5HGJ3_ORF16-01 ORF16 protein OS=[Viruses] Human herpesvirus 8 type P GN=ORF16 (length=175 residues).
MDEDVLPGEVLAIEGIFMACGLNEPEYLYHPLLSPIKLYITGLMRDKESLFEAMLANVRFHSTTGINQLGLSMLQVSGDG
NMNWGRALAILTFGSFVAQKLSNEPHLRDFALAVLPVYAYEAIGPQWFRARGGWRGLKAYCTQVLTRRRGRRMTALLGSI
ALLATILAAVAMSRR
>gnl|bcl2dbpro|Q76RI8_ORF16-01 ORF16 protein OS=[Viruses] Human herpesvirus 8 GN=ORF16 (length=175 residues).
MDEDVLPGEVLAIEGIFMACGLNEPEYLYHPLLSPIKLYITGLMRDKESLFEAMLANVRFHSTTGINQLGLSMLQVSGDG
NMNWGRALAILTFGSFVAQKLSNEPHLRDFALAVLPVYAYEAIGPQWFRARGGWRGLKAYCTQVLTRRRGRRMTALLGSI
ALLATILAAVAMSRR
© 1998-2018