Dataset for protein M11 of organism all

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|P89884_M11-01 M11 protein OS=[Viruses] Murid herpesvirus 4 GN=M11 (length=171 residues).
MSHKKSGTYWATLITAFLKTVSKVEELDCVDSAVLVDVSKIITLTQEFRRHYDSVYRADYGPALKNWKRDLSKLFTSLFV
DVINSGRIVGFFDVGRYVCEEVLCPGSWTEDHELLNDCMTHFFIENNLMNHFPLEDIFLAQRKFQTTGFTFLLHALAKVL
PRIYSGNVIYV
>gnl|bcl2dbpro|B1PZP0_M11-01 M11 protein OS=[Viruses] Murine herpesvirus 72 GN=M11 (length=171 residues).
MSHKKSGTYWATLITAFLKTVSKVEELDCVDSAVLVDVSKIITLTQEFRRHYDSVYRADYGPALKNWKRDLSKLFTSLFV
DVINSGRIVGFFDVGRYVCEEVLCPGSWTEDHELLNDCMTHFFIENNLMNHFPLEDIFLAQRKFQTTGFTFLLHALAKVL
PRIYSGNVIYV
>gnl|bcl2dbpro|D0U1R1_M11-01 M11 protein OS=[Viruses] Wood mouse herpesvirus GN=M11 (length=171 residues).
MSHKRTGTYWATIITAFLKSVSKVEELDCYDSDVLDDVSKIITLTQEFRSHYDSVFHMDYGPALQNWKGGLARLFTSLFG
DAINRGRIVGFFDVGRYVCEELLCPGSWTEEHDLLNEYMTQFFIENNLMNYFSLEDTFCTQTKFHNMGFSLALSILCRAL
TRIYSGDVIYV
© 1998-2018