Dataset for protein herpesviridae of organism all

[Download (right click)] [Alignment] [Repertoires]

76 sequence(s)

>gnl|bcl2dbpro|A0A1L2JVL1_A9-01 A9 protein OS=[Viruses] Alcelaphine gammaherpesvirus 1 GN=A9 (length=168 residues).
MKMLGEPEFKENILYYSFLNELFLILIRNGFSCSHAKLILDETRKRGLECSGQFEVISNSVEAPEPESLERIAKTLFTPR
PHWGRLVAFLAYLAYLQKNSTEKLFWNDHLKKLKQIVKCHIVPWTLGPRDPKPKQRPFDKLPSAFYFLTAAASCLTLLLL
YFRTTQTK
>gnl|bcl2dbpro|O36423_A9-01 A9 protein OS=[Viruses] Alcelaphine herpesvirus 1 GN=A9 (length=168 residues).
MKMLGEPEFKENILYYSFLNELFLILIRNGFSCSHAKLILDETRKRGLECSGQFEVISNSVEAPEPESLERIAKTLFTPR
PHWGRLVAFLAYLAYLQKNSTEKLFWNDHLKKLKQIVKCHIVPWTLGPRDPKPKQRPFDKLPSAFYFLTAAASCLTLLLL
YFRTTQTK
>gnl|bcl2dbpro|Q1XBS6_VBCL2-01 V-BCL-2 protein OS=[Viruses] Bovine herpesvirus 4 GN=V-BCL-2 (length=226 residues).
MSLFFVVWYWVNYITKVCSGEVYIPSVLKFQYHSDTEHEPYSNLCENLITMAEQDMDEVVSTIRRLLVECGMGLEEYLDH
PVTAPIKVAVQDVIRTKQDIFSNFLTNINSVEDLETLGHAITTLNDYPSPNMGRVVCGIAFSVYVVQTVCKRKPLLVRCC
LDIFTRATVQALNVNWFLQEGGWPALASFCKVVNSPSPRSRWLFPMLAISGLVLTVGVARNMVHFT
>gnl|bcl2dbpro|Q1XBS7_VBCL2-01 V-BCL-2 protein OS=[Viruses] Bovine herpesvirus 4 GN=V-BCL-2 (length=226 residues).
MSLFFVVWYWVNYITKVCSGEVYIPSVLKFQYHSDTEHEPYSNLCENLITMAEQDMDEVVSTIRRLLVECGMGLEEYLEH
PVTAPIKVAVQDVIRTKQDIFSNFLTNINSVEDLETLGHAITTLNDYPSPNMGRVVCGIAFSVYVVQTVCKRKPLLVRCC
LDIFTRATVQALNVNWFLQEGGWPALASFCKVVNSPSPRSRWLFPMLAISGLVLTVGVARNMVHFT
>gnl|bcl2dbpro|Q1XBS8_VBCL2-01 V-BCL-2 protein OS=[Viruses] Bovine herpesvirus 4 GN=V-BCL-2 (length=226 residues).
MSLFFIVWYWVNYITKVCSGEVYIPSVLKFQYHSDTEHEPYSNLCENLITMAEQDMDEVVSTIRRLLVECGMGLEEYLDH
PVTAPIKVAVQDVIRTKQDIFSNFLTNINSVEDLETLGHAITTLNDYPSPNMGRVVCGIAFSVYVVQTVCKRKPLLVRCC
LDIFTRATVQALNVNWFLQEGGWPALASFCKVVNSPSPRSRWLFPMLAISGLVLTVGVARNMVHFT
>gnl|bcl2dbpro|Q99D15_VBCL2-01 V-BCL-2 protein OS=[Viruses] Bovine herpesvirus 4 GN=V-BCL-2 (length=226 residues).
MSLFFVVWYWVNYITKVCFGEVYIPSVLKFQYHSDTEHEPYSNLCKNLITMAEQDMDEVVSTIRRLLVECGMGLEEYLEH
PVTAPIKVAVQDVIRTKQDIFSNFLTNINSVEDLETLGHAITTLNDYPSPNMGRVVCGIAFSVYVVQTVCKRKPLLVRCC
LDIFTRATVQALNVNWFLQEGGWPALASFCKVVNSPSPRSRWLFPMFAISGLVLTVGVARNMVHFT
>gnl|bcl2dbpro|Q9WH78_VBCL2-01 V-BCL-2 protein OS=[Viruses] Bovine herpesvirus 4 GN=V-BCL-2 (length=226 residues).
MSLFFVVWYWVNYITKVCSGEVYIPSVLKFQYHSDTEHEPYSNLCKNLITMAEQDMDEVVSTIRRLLVECGMGLEEYLEH
PVTAPIKVAVQDVIRTKQDIFSNFLTNINSVEDLETLGHAITTLNDYPSPNMGRVVCGIAFSVYVVQTVCKRKPLLVRCC
LDIFTRATVQALNVNWFLQEGGWPALASFCKVVNSPSPRSRWLFPMFAISGLVLTVGVARNMVHFT
>gnl|bcl2dbpro|Q99F66_BALF1-01 BALF1 protein OS=[Viruses] Cercopithecine herpesvirus 12 GN=BALF1 (length=182 residues).
MKAAKSTDSVFVRTPVEAWVSPSPPDDKVAETSYLLFRAMYAVFTQDETDLPTPAQVLCRLIKASLRKDKKLYAELACKT
ADIGGKHAHVQLIISILRAVYDDHYDYWSRLRVVLCYAVVFAVRNYLDDHESAAFVLGATAHYLALYRRVWFARIGGLPR
SLRRQFPVTWAIASLSDFLKSL
>gnl|bcl2dbpro|Q9Q5K8_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Cercopithecine herpesvirus 12 GN=BHRF1 (length=190 residues).
MAYSTRDLLLALCMRDGHVYGGDGLHPVLELTARESPFSVSPGDPLVLRLHALLEQIIVQNEDAFAETLVTFLLNTEDLD
LDFSRVFAEIFHNEDPTLGRGLAWLAWCMHACRTLCGDTNCPYYVVDLAVRGMLEASEGLDGWIGQHGGWPAVLRGNPSG
TRSSRWTIVFTGLTLSLLVVCSYIFISRRH
>gnl|bcl2dbpro|Q9WGB5_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Cercopithecine herpesvirus 12 GN=BHRF1 (length=190 residues).
MAYSTRDLLLALCMRDGHVYGGDGLHPVLELTARESPFSVSPGDPLVLRLHALLEQIIVQNEDAFAETLDRFLLNTEDLD
LDFSRVFAEIFHNEDPTLGRGLAWLAWCMHACRTLCGDTNCPYYVVDLAVRGMLEASEGLDGWIGQHGGWPAVLRGNPSG
TRSSRWTIVFTGLTLSLLVVCSYIFISRRH
>gnl|bcl2dbpro|Q90343_vNR13-01 vNR13 protein OS=[Eukaryota] Coturnix japonica GN=vNR13 (length=177 residues).
MPGSLKEETALLLEDYFQHRAGGAALPPSATAAELRRAAAELERRERPFFRSCAPLARAEPREAAALLRKVAAQLETDGG
LNWGRLLALVVFAGTLAAALAESACEEGPSRLAAALTAYLAEEQGEWMEEHGGWDGFCRFFGRHGSQPADQNSTLSNAIM
AAAGFGIAGLAFLLVVR
>gnl|bcl2dbpro|A0A075FCZ0_BALF1-01 BALF1 protein OS=[Viruses] Epstein-Barr virus GN=BALF1 (length=182 residues).
MRPAKSTDSVFVRTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRT
ADIGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPR
SLKRQFPVTWALASLTDFLKSL
>gnl|bcl2dbpro|A0A075FFB0_BALF1-01 BALF1 protein OS=[Viruses] Epstein-Barr virus GN=BALF1 (length=182 residues).
MRPAKSTDSVFVRTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLIKASLRKDRRLYAELACRT
ADIGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPR
SLRRQFPVTWALASLTDFLKSL
>gnl|bcl2dbpro|A0A0B6VHG4_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTENLD
LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQYTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|A0A0C7SXB3_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCFNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|A0A0C7T306_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETHLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|A0A0C7T6R4_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFSETWNRFITHTEHVD
LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|A0A0C7T8J1_BALF1-01 BALF1 protein OS=[Viruses] Epstein-Barr virus GN=BALF1 (length=182 residues).
MRPAKSTDSVFVRTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRT
ADIGGKDTHVRIIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPR
SLRRQFPVTWALASLTDFLKSL
>gnl|bcl2dbpro|A0A0C7T924_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRKFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|A0A0C7TJ32_BALF1-01 BALF1 protein OS=[Viruses] Epstein-Barr virus GN=BALF1 (length=182 residues).
MRPAKSTDSVFVRTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRT
ADIGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLNDHKSAAFVLGAIAHYLALYRRLWFARLGGMPR
SLRRQFPVTWALASLTDFLKSL
>gnl|bcl2dbpro|A0A0C7TK05_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNPSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|A0A0C7TLW1_BALF1-01 BALF1 protein OS=[Viruses] Epstein-Barr virus GN=BALF1 (length=182 residues).
MRPAKSTDSVFVRTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLIKASLRKDRKLYADLACRT
ADIGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPR
SLRRQFPVTWALASLTDFLKSL
>gnl|bcl2dbpro|A0A0C7TNT4_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
LDFNSVFLEIFHRGDPSLGRTLAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|A0A0C7TPI3_BALF1-01 BALF1 protein OS=[Viruses] Epstein-Barr virus GN=BALF1 (length=182 residues).
MRPAKSTDSVFVRTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRT
ADVGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPR
SLRRQFPVTWALASLTDFLKSL
>gnl|bcl2dbpro|A0A0C7TQI4_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTRDILLALCIRDSRVHGNGALHPVLELAARETPPRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTENLD
LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQYTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIENNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|A0A0C7TTN2_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLHLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|A0A0C7TUX3_BALF1-01 BALF1 protein OS=[Viruses] Epstein-Barr virus GN=BALF1 (length=182 residues).
MRQAKSTDSVFVRTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRT
ADIGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPR
SLRRQFPVTWALASLTDFLKSL
>gnl|bcl2dbpro|A0A0C7TV67_BALF1-01 BALF1 protein OS=[Viruses] Epstein-Barr virus GN=BALF1 (length=182 residues).
MRPAKSTDSVFVRTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFARDEKDLPLPALVLCRLIKASLRKDRKLYAELACRT
ADIGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRIWFARLGGMPR
SLRRQFPVTWALASLTDFLKSL
>gnl|bcl2dbpro|A0A0C7TWM2_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLLPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|A0A0C7TX82_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
LDFNSVFLEIFHRGDPSLGRALAWMAWCMYACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|A0A0C7U1E2_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGTLHPVLELASRETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCYNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|A0A0S2YQS0_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAHSTREILLALCIRDSRVHGNGVLHPVLELAARETPPRVSPEDTVVLRYHVLLEEIIERNSDTFTETWDRFITHTEHLD
LDFNSIFLEIFHRGDPSRGRALAWLAWCMHACRTLCCNQDTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRSFSWTLFLAGLTLSLLVVCSYLFISRGRH
>gnl|bcl2dbpro|A0A0S2YQW9_BALF1-01 BALF1 protein OS=[Viruses] Epstein-Barr virus GN=BALF1 (length=220 residues).
MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRQAKSTDSVFVRTPVEAWVAPSPPDDKVAESSYLMFRAMYA
VFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFA
VRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSLRRQFPVTWALASLTDFLKSL
>gnl|bcl2dbpro|A0A0S2YRE8_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
LDFNSVFLEIFHRGDPRLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|A0A0U3U737_BALF1-01 BALF1 protein OS=[Viruses] Epstein-Barr virus GN=BALF1 (length=220 residues).
MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFVRTPVEAWVAPSPPDDKVAESSYLMFRAMYA
VFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADIGDKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFA
VRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSLRRQFPVTWALASLTDFLKSL
>gnl|bcl2dbpro|A0A0U3UKR9_BALF1-01 BALF1 protein OS=[Viruses] Epstein-Barr virus GN=BALF1 (length=220 residues).
MNLAIALDSPHPGLASYTILPRPFYHISLKPVNWPDETMRPAKSTDSVFVRTPVEAWVAPSPPDDKVAESSYLMFRAMYA
VFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADIRGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFA
VRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSLRRQFPVTWALASLTDFLKSL
>gnl|bcl2dbpro|A0A0X8YIW3_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRALCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|A0A0X9C4Q9_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFIRHTEHLD
LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|A0A2D1LYV4_BALF1-01 BALF1 protein OS=[Viruses] Epstein-Barr virus GN=BALF1 (length=182 residues).
MRPAKSTDSVFVRTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRT
ADIGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPR
SLRCQFPVTWALASLTDFLKSL
>gnl|bcl2dbpro|A0A2D1LYW3_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLLPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRRLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|A0A2H4Z4C5_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTDHLD
LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|A0A2H4Z4D6_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTANLD
LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQYTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|A0A2H4Z4D9_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
LDFNSVFVEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFIWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|A0A2H4Z4E3_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNSFITHTEHVD
LDFNSVFVEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|A0A2H4Z4F2_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHLD
LDFNSVFLEIFHRGDPSLGCALTWMAWGMHACWTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|A0A2H4Z4F8_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGILHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
LDFNSVFVEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|A0A2H4Z4H8_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNASLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHLD
LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|A0A2H4Z4I0_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTRDILLALCIRDSRVHGNGALHPVLELAARETPPRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHLD
LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|A0A2H4Z4I4_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGSLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHLD
LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|A0A2H4Z4M5_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGSLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHLD
LDFNSVFFEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|G3CKQ0_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHLD
LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|K9UT94_BALF1-01 BALF1 protein OS=[Viruses] Epstein-Barr virus GN=BALF1 (length=182 residues).
MRPAKSTDSVFVRTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRT
ADIGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPR
SLRRQFPVTWALASLTDFLKSL
>gnl|bcl2dbpro|K9UTF7_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
LDFNSVFVEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|K9UTN7_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|P03182_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|P0C6Z1_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|P0CK58_BALF1-01 BALF1 protein OS=[Viruses] Epstein-Barr virus GN=BALF1 (length=220 residues).
MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFVRTPVEAWVAPSPPDDKVAESSYLMFRAMYA
VFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFA
VRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSLRRQFPVTWALASLTDFLKSL
>gnl|bcl2dbpro|P0CK59_BALF1-01 BALF1 protein OS=[Viruses] Epstein-Barr virus GN=BALF1 (length=220 residues).
MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFVRTPVEAWVAPSPPDDKVAESSYLMFRAMYA
VFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFA
VRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSLRRQFPVTWALASLTDFLKSL
>gnl|bcl2dbpro|Q91HV2_BALF1-01 BALF1 protein OS=[Viruses] Epstein-Barr virus GN=BALF1 (length=220 residues).
MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFVRTPVEAWVAPSPPDDKVAESSYLMFRAMYA
VFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFA
VRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSLRCQFPVTWALASLTDFLKSL
>gnl|bcl2dbpro|U5YUM6_BALF1-01 BALF1 protein OS=[Viruses] Epstein-Barr virus GN=BALF1 (length=220 residues).
MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFVKTPVEAWVAPSPPDDKVAESSYLMFRAMYA
VFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFA
VRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSLRRQFPVTWALASLTDFLKSL
>gnl|bcl2dbpro|V5KU29_BHRF1-02 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRQ
>gnl|bcl2dbpro|V5KUE2_BHRF1-02 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGTLHPVLELASRETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|Q91HI3_BALF1-01 BALF1 protein OS=[Viruses] Gorilline gammaherpesvirus 1 GN=BALF1 (length=182 residues).
MRPAKSTDSVFVRTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTQDETGLPLPAMVLCRLIKASLKKDKKLYAELACKT
ADIGGKHAHVQLIISVLRAVYDDHYDYWSRLRVVLCYTVVFAVRNYLDDHESAAFVLGAIAHYLALYRRLWFARMGGMPR
SLRRQFPVRWALAGLTYFLKSL
>gnl|bcl2dbpro|P90504_ORF16-01 ORF16 protein OS=[Viruses] Human herpesvirus 8 type M GN=ORF16 (length=175 residues).
MDEDVLPGEVLAIEGIFMACGLNEPEYLYHPLLSPIKLYITGLMRDKESLFEAMLANVRFHSTTGINQLGLSMLQVSGDG
NMNWGRALAILTFGSFVAQKLSNEPHLRDFALAVLPVYAYEAIGPQWFRARGGWRGLKAYCTQVLTRRRGRRMTALLGSI
ALLATILAAVAMSRR
>gnl|bcl2dbpro|F5HGJ3_ORF16-01 ORF16 protein OS=[Viruses] Human herpesvirus 8 type P GN=ORF16 (length=175 residues).
MDEDVLPGEVLAIEGIFMACGLNEPEYLYHPLLSPIKLYITGLMRDKESLFEAMLANVRFHSTTGINQLGLSMLQVSGDG
NMNWGRALAILTFGSFVAQKLSNEPHLRDFALAVLPVYAYEAIGPQWFRARGGWRGLKAYCTQVLTRRRGRRMTALLGSI
ALLATILAAVAMSRR
>gnl|bcl2dbpro|Q76RI8_ORF16-01 ORF16 protein OS=[Viruses] Human herpesvirus 8 GN=ORF16 (length=175 residues).
MDEDVLPGEVLAIEGIFMACGLNEPEYLYHPLLSPIKLYITGLMRDKESLFEAMLANVRFHSTTGINQLGLSMLQVSGDG
NMNWGRALAILTFGSFVAQKLSNEPHLRDFALAVLPVYAYEAIGPQWFRARGGWRGLKAYCTQVLTRRRGRRMTALLGSI
ALLATILAAVAMSRR
>gnl|bcl2dbpro|H3ALX7_vNR13-01 vNR13 protein OS=[Eukaryota] Latimeria chalumnae GN=vNR13 (length=178 residues).
MCDSLKEETRLLANDFIQFCLGSGRTAPNPAARVLRRVTAELERQNQALFDSFQGNCGPEAELGSVLKRVAEQLEAEGGL
NWGRVVSLFAFAGCLAKGVQRAQNEECAMGACCGKLAEALVNYLAKERGDWLEENGGWDGFYKFFERSDHYQESTVRNAL
MAAAGFGIAGLAFLLAVR
>gnl|bcl2dbpro|Q9E1F2_vNR13-01 vNR13 protein OS=[Viruses] Meleagrid herpesvirus 1 GN=vNR13 (length=179 residues).
MADSLKEETALLLEDYFQHCCGKEGPPPSPTAAELRRAAAELERRERPFFRSCAPLASGGTQAALSALQSVVSELNSGSG
FNWGRCLATIVLGGSLATALYENGCEEGPSRLAAALAAYLAEEQGEWLREHGGWDGFCRFFARFGPGLGEASQTFPLGLI
VAAAGIGITVLIVVWQFQS
>gnl|bcl2dbpro|Q9E1F2_vNR13-02 vNR13 protein OS=[Viruses] Meleagrid herpesvirus 1 GN=vNR13 (length=162 residues).
MADSLKEETALLLEDYFQHCCGKEGPPPSPTAAELRRAAAELERRERPFFRSCAPLASGGTQAALSALQSVVSELNSGSG
FNWGRCLATIVLGGSLATALYENGCEEGPSRLAAALAAYLAEEQGEWLREHGGWVSTARAGMSGSFGSPVSARSEEHRAR
RW
>gnl|bcl2dbpro|P89884_M11-01 M11 protein OS=[Viruses] Murid herpesvirus 4 GN=M11 (length=171 residues).
MSHKKSGTYWATLITAFLKTVSKVEELDCVDSAVLVDVSKIITLTQEFRRHYDSVYRADYGPALKNWKRDLSKLFTSLFV
DVINSGRIVGFFDVGRYVCEEVLCPGSWTEDHELLNDCMTHFFIENNLMNHFPLEDIFLAQRKFQTTGFTFLLHALAKVL
PRIYSGNVIYV
>gnl|bcl2dbpro|B1PZP0_M11-01 M11 protein OS=[Viruses] Murine herpesvirus 72 GN=M11 (length=171 residues).
MSHKKSGTYWATLITAFLKTVSKVEELDCVDSAVLVDVSKIITLTQEFRRHYDSVYRADYGPALKNWKRDLSKLFTSLFV
DVINSGRIVGFFDVGRYVCEEVLCPGSWTEDHELLNDCMTHFFIENNLMNHFPLEDIFLAQRKFQTTGFTFLLHALAKVL
PRIYSGNVIYV
>gnl|bcl2dbpro|A1BM64_A9-01 A9 protein OS=[Viruses] Ovine gammaherpesvirus 2 GN=A9 (length=206 residues).
MVEAGILSRKVTTGSHWTFFTPQTLKKGACLWKAGAVYFPPASMPPRKAFNDGDLLYFNFTREIHMLLIKSGIPCSYAKG
IMRAARTKAVDCSSTFEVIVDGVGHPSPESLERIAKSLFTPRPNWGRVVMFFAYLFYLQISSTQKVFFRDHYKKIESIIE
AHIVPWTLSQRKLKEPFPLKMREVVIFFTTVASLVAMLLFCRRAWS
>gnl|bcl2dbpro|Q2VSG7_A9-01 A9 protein OS=[Viruses] Ovine gammaherpesvirus 2 GN=A9 (length=206 residues).
MVEAGILSRKVTTGSHWTFFTPQTLKKGACLWKAGAVYFPPVSMPPRKAFNDGDLLYFNFTREIHMLLIKSGIPCSYAKG
IMRAARTKAVDCSSTFEVIVDGVGHPSPESLERIAKSLFTPRPNWGRVVMFFAYLFYLQISSTQKVFFRDHYKKIESIIE
AHIVPWTLSQRKLKEPFPLKMREVVIFFTTVASLVAMLLLCRRAWG
>gnl|bcl2dbpro|Q99F65_BALF1-01 BALF1 protein OS=[Viruses] Panine gammaherpesvirus 1 GN=BALF1 (length=182 residues).
MRPAESTDSVFVRTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFSRDESDLPLPAAVLCRLIKASLKKDRKLYAELACKT
ADIGGRHAHVQLITSVLRAVYDDHCDYWSRLRVVLCYTVVFAVRNYLDDHRSAAFVLGAIAHYLALYRRLWFARMGGMPR
SLRRQFPVTWAMAGLTDFLKSL
>gnl|bcl2dbpro|Q9IHR2_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Panine gammaherpesvirus 1 GN=BHRF1 (length=191 residues).
MAYSTRDILLALCMRDSYVHGNGSLHPVLELAARETPPRVSPEDTVVLRLHLLLEEVIQQNAESFTNTWETFITNAEHVD
LDFAAVFEDIFHRGDPSLGRALAWLAWCMHACRTLCRNQNTPYYVVDLSVRGMLEASEGLDAWIHQQGGWTGLIRSDSLG
STNSRWTLLFAGLTLSLLIVCSYLFISRGRH
>gnl|bcl2dbpro|D0U1R1_M11-01 M11 protein OS=[Viruses] Wood mouse herpesvirus GN=M11 (length=171 residues).
MSHKRTGTYWATIITAFLKSVSKVEELDCYDSDVLDDVSKIITLTQEFRSHYDSVFHMDYGPALQNWKGGLARLFTSLFG
DAINRGRIVGFFDVGRYVCEELLCPGSWTEEHDLLNEYMTQFFIENNLMNYFSLEDTFCTQTKFHNMGFSLALSILCRAL
TRIYSGDVIYV
© 1998-2018