Dataset for protein BALF1 of organism all

[Download (right click)] [Alignment] [Repertoires]

20 sequence(s)

>gnl|bcl2dbpro|Q99F66_BALF1-01 BALF1 protein OS=[Viruses] Cercopithecine herpesvirus 12 GN=BALF1 (length=182 residues).
MKAAKSTDSVFVRTPVEAWVSPSPPDDKVAETSYLLFRAMYAVFTQDETDLPTPAQVLCRLIKASLRKDKKLYAELACKT
ADIGGKHAHVQLIISILRAVYDDHYDYWSRLRVVLCYAVVFAVRNYLDDHESAAFVLGATAHYLALYRRVWFARIGGLPR
SLRRQFPVTWAIASLSDFLKSL
>gnl|bcl2dbpro|A0A075FCZ0_BALF1-01 BALF1 protein OS=[Viruses] Epstein-Barr virus GN=BALF1 (length=182 residues).
MRPAKSTDSVFVRTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRT
ADIGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPR
SLKRQFPVTWALASLTDFLKSL
>gnl|bcl2dbpro|A0A075FFB0_BALF1-01 BALF1 protein OS=[Viruses] Epstein-Barr virus GN=BALF1 (length=182 residues).
MRPAKSTDSVFVRTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLIKASLRKDRRLYAELACRT
ADIGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPR
SLRRQFPVTWALASLTDFLKSL
>gnl|bcl2dbpro|A0A0C7T8J1_BALF1-01 BALF1 protein OS=[Viruses] Epstein-Barr virus GN=BALF1 (length=182 residues).
MRPAKSTDSVFVRTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRT
ADIGGKDTHVRIIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPR
SLRRQFPVTWALASLTDFLKSL
>gnl|bcl2dbpro|A0A0C7TJ32_BALF1-01 BALF1 protein OS=[Viruses] Epstein-Barr virus GN=BALF1 (length=182 residues).
MRPAKSTDSVFVRTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRT
ADIGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLNDHKSAAFVLGAIAHYLALYRRLWFARLGGMPR
SLRRQFPVTWALASLTDFLKSL
>gnl|bcl2dbpro|A0A0C7TLW1_BALF1-01 BALF1 protein OS=[Viruses] Epstein-Barr virus GN=BALF1 (length=182 residues).
MRPAKSTDSVFVRTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLIKASLRKDRKLYADLACRT
ADIGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPR
SLRRQFPVTWALASLTDFLKSL
>gnl|bcl2dbpro|A0A0C7TPI3_BALF1-01 BALF1 protein OS=[Viruses] Epstein-Barr virus GN=BALF1 (length=182 residues).
MRPAKSTDSVFVRTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRT
ADVGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPR
SLRRQFPVTWALASLTDFLKSL
>gnl|bcl2dbpro|A0A0C7TUX3_BALF1-01 BALF1 protein OS=[Viruses] Epstein-Barr virus GN=BALF1 (length=182 residues).
MRQAKSTDSVFVRTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRT
ADIGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPR
SLRRQFPVTWALASLTDFLKSL
>gnl|bcl2dbpro|A0A0C7TV67_BALF1-01 BALF1 protein OS=[Viruses] Epstein-Barr virus GN=BALF1 (length=182 residues).
MRPAKSTDSVFVRTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFARDEKDLPLPALVLCRLIKASLRKDRKLYAELACRT
ADIGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRIWFARLGGMPR
SLRRQFPVTWALASLTDFLKSL
>gnl|bcl2dbpro|A0A0S2YQW9_BALF1-01 BALF1 protein OS=[Viruses] Epstein-Barr virus GN=BALF1 (length=220 residues).
MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRQAKSTDSVFVRTPVEAWVAPSPPDDKVAESSYLMFRAMYA
VFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFA
VRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSLRRQFPVTWALASLTDFLKSL
>gnl|bcl2dbpro|A0A0U3U737_BALF1-01 BALF1 protein OS=[Viruses] Epstein-Barr virus GN=BALF1 (length=220 residues).
MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFVRTPVEAWVAPSPPDDKVAESSYLMFRAMYA
VFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADIGDKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFA
VRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSLRRQFPVTWALASLTDFLKSL
>gnl|bcl2dbpro|A0A0U3UKR9_BALF1-01 BALF1 protein OS=[Viruses] Epstein-Barr virus GN=BALF1 (length=220 residues).
MNLAIALDSPHPGLASYTILPRPFYHISLKPVNWPDETMRPAKSTDSVFVRTPVEAWVAPSPPDDKVAESSYLMFRAMYA
VFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADIRGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFA
VRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSLRRQFPVTWALASLTDFLKSL
>gnl|bcl2dbpro|A0A2D1LYV4_BALF1-01 BALF1 protein OS=[Viruses] Epstein-Barr virus GN=BALF1 (length=182 residues).
MRPAKSTDSVFVRTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRT
ADIGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPR
SLRCQFPVTWALASLTDFLKSL
>gnl|bcl2dbpro|K9UT94_BALF1-01 BALF1 protein OS=[Viruses] Epstein-Barr virus GN=BALF1 (length=182 residues).
MRPAKSTDSVFVRTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRT
ADIGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPR
SLRRQFPVTWALASLTDFLKSL
>gnl|bcl2dbpro|P0CK58_BALF1-01 BALF1 protein OS=[Viruses] Epstein-Barr virus GN=BALF1 (length=220 residues).
MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFVRTPVEAWVAPSPPDDKVAESSYLMFRAMYA
VFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFA
VRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSLRRQFPVTWALASLTDFLKSL
>gnl|bcl2dbpro|P0CK59_BALF1-01 BALF1 protein OS=[Viruses] Epstein-Barr virus GN=BALF1 (length=220 residues).
MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFVRTPVEAWVAPSPPDDKVAESSYLMFRAMYA
VFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFA
VRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSLRRQFPVTWALASLTDFLKSL
>gnl|bcl2dbpro|Q91HV2_BALF1-01 BALF1 protein OS=[Viruses] Epstein-Barr virus GN=BALF1 (length=220 residues).
MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFVRTPVEAWVAPSPPDDKVAESSYLMFRAMYA
VFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFA
VRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSLRCQFPVTWALASLTDFLKSL
>gnl|bcl2dbpro|U5YUM6_BALF1-01 BALF1 protein OS=[Viruses] Epstein-Barr virus GN=BALF1 (length=220 residues).
MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFVKTPVEAWVAPSPPDDKVAESSYLMFRAMYA
VFTRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFA
VRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSLRRQFPVTWALASLTDFLKSL
>gnl|bcl2dbpro|Q91HI3_BALF1-01 BALF1 protein OS=[Viruses] Gorilline gammaherpesvirus 1 GN=BALF1 (length=182 residues).
MRPAKSTDSVFVRTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTQDETGLPLPAMVLCRLIKASLKKDKKLYAELACKT
ADIGGKHAHVQLIISVLRAVYDDHYDYWSRLRVVLCYTVVFAVRNYLDDHESAAFVLGAIAHYLALYRRLWFARMGGMPR
SLRRQFPVRWALAGLTYFLKSL
>gnl|bcl2dbpro|Q99F65_BALF1-01 BALF1 protein OS=[Viruses] Panine gammaherpesvirus 1 GN=BALF1 (length=182 residues).
MRPAESTDSVFVRTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFSRDESDLPLPAAVLCRLIKASLKKDRKLYAELACKT
ADIGGRHAHVQLITSVLRAVYDDHCDYWSRLRVVLCYTVVFAVRNYLDDHRSAAFVLGAIAHYLALYRRLWFARMGGMPR
SLRRQFPVTWAMAGLTDFLKSL
© 1998-2018