Dataset for protein A9 of organism all

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A1L2JVL1_A9-01 A9 protein OS=[Viruses] Alcelaphine gammaherpesvirus 1 GN=A9 (length=168 residues).
MKMLGEPEFKENILYYSFLNELFLILIRNGFSCSHAKLILDETRKRGLECSGQFEVISNSVEAPEPESLERIAKTLFTPR
PHWGRLVAFLAYLAYLQKNSTEKLFWNDHLKKLKQIVKCHIVPWTLGPRDPKPKQRPFDKLPSAFYFLTAAASCLTLLLL
YFRTTQTK
>gnl|bcl2dbpro|O36423_A9-01 A9 protein OS=[Viruses] Alcelaphine herpesvirus 1 GN=A9 (length=168 residues).
MKMLGEPEFKENILYYSFLNELFLILIRNGFSCSHAKLILDETRKRGLECSGQFEVISNSVEAPEPESLERIAKTLFTPR
PHWGRLVAFLAYLAYLQKNSTEKLFWNDHLKKLKQIVKCHIVPWTLGPRDPKPKQRPFDKLPSAFYFLTAAASCLTLLLL
YFRTTQTK
>gnl|bcl2dbpro|A1BM64_A9-01 A9 protein OS=[Viruses] Ovine gammaherpesvirus 2 GN=A9 (length=206 residues).
MVEAGILSRKVTTGSHWTFFTPQTLKKGACLWKAGAVYFPPASMPPRKAFNDGDLLYFNFTREIHMLLIKSGIPCSYAKG
IMRAARTKAVDCSSTFEVIVDGVGHPSPESLERIAKSLFTPRPNWGRVVMFFAYLFYLQISSTQKVFFRDHYKKIESIIE
AHIVPWTLSQRKLKEPFPLKMREVVIFFTTVASLVAMLLFCRRAWS
>gnl|bcl2dbpro|Q2VSG7_A9-01 A9 protein OS=[Viruses] Ovine gammaherpesvirus 2 GN=A9 (length=206 residues).
MVEAGILSRKVTTGSHWTFFTPQTLKKGACLWKAGAVYFPPVSMPPRKAFNDGDLLYFNFTREIHMLLIKSGIPCSYAKG
IMRAARTKAVDCSSTFEVIVDGVGHPSPESLERIAKSLFTPRPNWGRVVMFFAYLFYLQISSTQKVFFRDHYKKIESIIE
AHIVPWTLSQRKLKEPFPLKMREVVIFFTTVASLVAMLLLCRRAWG
© 1998-2018