Dataset for protein herpesviridae of organism Wood mouse herpesvirus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|D0U1R1_M11-01 M11 protein OS=[Viruses] Wood mouse herpesvirus GN=M11 (length=171 residues).
MSHKRTGTYWATIITAFLKSVSKVEELDCYDSDVLDDVSKIITLTQEFRSHYDSVFHMDYGPALQNWKGGLARLFTSLFG
DAINRGRIVGFFDVGRYVCEELLCPGSWTEEHDLLNEYMTQFFIENNLMNYFSLEDTFCTQTKFHNMGFSLALSILCRAL
TRIYSGDVIYV
© 1998-2018