Dataset for protein Unclassified of organism Saimiriine herpesvirus 2

[Download (right click)]

2 sequence(s)

>gnl|bcl2dbpro|O40636_uncORF16-01 Putative ORF16 protein OS=[Viruses] Saimiriine herpesvirus 2 (length=160 residues).
MSSIRFQNIVENILNKCQDNKHSQDSVVRAIHSVIHQYNKFEALMPDFSLCVHDRLKFTGEAILLTTEHTTNWGKVVAML
SFSAAVLQTIDEEYKCVATSMLSSYIARSVGANWFMENGGEKSLVKFCNSIMPKNPFNVLNFLVPAVLAGFVLIQTLLIK
>gnl|bcl2dbpro|Q01001_uncORF16-01 Putative ORF16 protein OS=[Viruses] Saimiriine herpesvirus 2 (length=160 residues).
MSSIKFQNIIENILKKCQDNRHSQDSVVRAVHSVIHQYNKFEALMPDFSLCVHDRIKFTGEAILLTTEHTTNWGKVVAML
SFSAAVLQTIDEEYKCVATSMLSSYISRSVGANWFIENGGEKSLVEFCNSIMPQNPFNVLNFLVPAVLAGLVLMQTLLIK
© 1998-2018