Dataset for protein Unclassified of organism Rhesus monkey rhadinovirus H26 95

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|Q77NK4_uncORF16-01 Putative ORF16 protein OS=[Viruses] Rhesus monkey rhadinovirus H26-95 (length=187 residues).
MAAVQGPPPPPEEENENSLPVDVYAIEGIFLYCGLGQAEYLHHPVFSPIKEFISAFLKDSARLYERLLRHTDYRSLRGLN
AIGQGMLQINTDGRHNWGRALAVLGLGAYVVDKVKDDERLLTFAIAVLPVYAYEALESQWFRSHGEWEGLRNYCERILRH
RRNARRHMCYGVAAGLLALVALFAIRR
© 1998-2018