Dataset for protein Unclassified of organism Retroperitoneal fibromatosis associated herpesvirus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|U5NM37_uncORF16-01 Putative ORF16 protein OS=[Viruses] Retroperitoneal fibromatosis-associated herpesvirus (length=178 residues).
MQSRQLPPDVAAIEGILLVCGLDRPEYVHHPVLSPIRTCVSYIVRTRAEDFNQMLDDARIESVAGLARLGRGMLHMNREG
GMNWGRALALLALGCTAIRRLSPNRHLTAFAMGMFPLYMYQAIGPQWFRAHGGWSGFKIYCERYTQEQETLRLLLVFAAV
GLVAAVSACWVAYRRGSW
© 1998-2018