Dataset for protein Unclassified of organism Paramormyrops kingsleyae

[Download (right click)]

4 sequence(s)

>gnl|bcl2dbpro|A0A3B3TEX4_uncvNR13-01 Putative vNR13 protein OS=[Eukaryota] Paramormyrops kingsleyae (length=199 residues).
MATSLQDETLVVANDYMDFCIGIKRTPPSEFAKAMRYMAKKVENKHRSSLHQLVETFCRYGGFNTWTKLKNFMLDVFGGE
STSWGEILILFAFAGILAVQLSTTDEDVACSRRLAEMISDVLEEKQEWMIQNGGWMGFMDYVHTVKPGYSESPLKKALPA
AATVAIASLLTGYLLKRTLPDLLPSSFSILKKLPGTSVC
>gnl|bcl2dbpro|A0A3B3TEX4_uncvNR13-03 Putative vNR13 protein OS=[Eukaryota] Paramormyrops kingsleyae (length=231 residues).
MVTETLIYTAGWESMLISSLDKKMGILKFACATGVVAAAAGAAYLYRRFRRTPEQEEVNMATSLQDETLVVANDYMDFCI
GIKRTPPSEFAKAMRYMAKKVENKHRSSLHQLVETFCRYGGFNTWTKLKNFMLDVFGGESTSWGEILILFAFAGILAVQL
STTDEDVACSRRLAEMISDVLEEKQEWMIQNGGWMGFMDYVHTVKPGYSESPLKKALPAAATVAIASLLVR
>gnl|bcl2dbpro|A0A3B3TEX4_uncvNR13-02 Putative vNR13 protein OS=[Eukaryota] Paramormyrops kingsleyae (length=250 residues).
MGILKFACATGVVAAAAGAAYLYRRFRRTPEQEEVNMATSLQDETLVVANDYMDFCIGIKRTPPSEFAKAMRYMAKKVEN
KHRSSLHQLVETFCRYGGFNTWTKLKNFMLDVFGGESTSWGEILILFAFAGILAVQLSTTDEDVACSRRLAEMISDVLEE
KQEWMIQNGGWMGFMDYVHTVKPGYSESPLKKALPAAATVAIASLLVHRLSTKKNPTRLAPIFIFNPQETARNISLLDGT
FYQKHALSVL
>gnl|bcl2dbpro|A0A3B3TFS5_uncvNR13-01 Putative vNR13 protein OS=[Eukaryota] Paramormyrops kingsleyae (length=176 residues).
MSSSLQNETLMVADDYMKFCIGISSTPPSESAKAMRCLAKEVESSQGPTLRALVQTFLIACGADPWTGLRSVMLELVGDG
RLNWGRVISLFAFTGMLASELCSRGEDVSCSRRLAEMMVDFLNGEKQEWLIQNGGWGGFTNFVHTARPADQDSSMRKALY
AAAGVGIAGITFLLVR
© 1998-2019