Dataset for protein herpesviridae of organism Panine gammaherpesvirus 1

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|Q99F65_BALF1-01 BALF1 protein OS=[Viruses] Panine gammaherpesvirus 1 GN=BALF1 (length=182 residues).
MRPAESTDSVFVRTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFSRDESDLPLPAAVLCRLIKASLKKDRKLYAELACKT
ADIGGRHAHVQLITSVLRAVYDDHCDYWSRLRVVLCYTVVFAVRNYLDDHRSAAFVLGAIAHYLALYRRLWFARMGGMPR
SLRRQFPVTWAMAGLTDFLKSL
>gnl|bcl2dbpro|Q9IHR2_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Panine gammaherpesvirus 1 GN=BHRF1 (length=191 residues).
MAYSTRDILLALCMRDSYVHGNGSLHPVLELAARETPPRVSPEDTVVLRLHLLLEEVIQQNAESFTNTWETFITNAEHVD
LDFAAVFEDIFHRGDPSLGRALAWLAWCMHACRTLCRNQNTPYYVVDLSVRGMLEASEGLDAWIHQQGGWTGLIRSDSLG
STNSRWTLLFAGLTLSLLIVCSYLFISRGRH
© 1998-2018