Dataset for protein BHRF1 of organism Panine gammaherpesvirus 1

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|Q9IHR2_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Panine gammaherpesvirus 1 GN=BHRF1 (length=191 residues).
MAYSTRDILLALCMRDSYVHGNGSLHPVLELAARETPPRVSPEDTVVLRLHLLLEEVIQQNAESFTNTWETFITNAEHVD
LDFAAVFEDIFHRGDPSLGRALAWLAWCMHACRTLCRNQNTPYYVVDLSVRGMLEASEGLDAWIHQQGGWTGLIRSDSLG
STNSRWTLLFAGLTLSLLIVCSYLFISRGRH
© 1998-2018