Dataset for protein A9 of organism Ovine gammaherpesvirus 2

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A1BM64_A9-01 A9 protein OS=[Viruses] Ovine gammaherpesvirus 2 GN=A9 (length=206 residues).
MVEAGILSRKVTTGSHWTFFTPQTLKKGACLWKAGAVYFPPASMPPRKAFNDGDLLYFNFTREIHMLLIKSGIPCSYAKG
IMRAARTKAVDCSSTFEVIVDGVGHPSPESLERIAKSLFTPRPNWGRVVMFFAYLFYLQISSTQKVFFRDHYKKIESIIE
AHIVPWTLSQRKLKEPFPLKMREVVIFFTTVASLVAMLLFCRRAWS
>gnl|bcl2dbpro|Q2VSG7_A9-01 A9 protein OS=[Viruses] Ovine gammaherpesvirus 2 GN=A9 (length=206 residues).
MVEAGILSRKVTTGSHWTFFTPQTLKKGACLWKAGAVYFPPVSMPPRKAFNDGDLLYFNFTREIHMLLIKSGIPCSYAKG
IMRAARTKAVDCSSTFEVIVDGVGHPSPESLERIAKSLFTPRPNWGRVVMFFAYLFYLQISSTQKVFFRDHYKKIESIIE
AHIVPWTLSQRKLKEPFPLKMREVVIFFTTVASLVAMLLLCRRAWG
© 1998-2018