Dataset for protein Unclassified of organism Osmerus mordax

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|C1BL36_uncvNR13-01 Putative vNR13 protein OS=[Eukaryota] Osmerus mordax (length=186 residues).
MSCRLWKETLALGEDYLAFCCASPRLAPPPPSEPAAAMRRLAQDMETLNSVSFQALSKNLLCHSEQDPCASLRAVLKEIV
VDGKLNWGRVVCIFTFTGVLARQLQEQKSKGQDIGQGPDKCRGLAEAIADFLGEEKKDWLQENGGWEGLCKFSDCARGMN
QDSSMKTALFAVAGVGIAGLTFLLGR
© 1998-2018