Dataset for protein herpesviridae of organism Murine herpesvirus 72

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|B1PZP0_M11-01 M11 protein OS=[Viruses] Murine herpesvirus 72 GN=M11 (length=171 residues).
MSHKKSGTYWATLITAFLKTVSKVEELDCVDSAVLVDVSKIITLTQEFRRHYDSVYRADYGPALKNWKRDLSKLFTSLFV
DVINSGRIVGFFDVGRYVCEEVLCPGSWTEDHELLNDCMTHFFIENNLMNHFPLEDIFLAQRKFQTTGFTFLLHALAKVL
PRIYSGNVIYV
© 1998-2018