Dataset for protein herpesviridae of organism Murid herpesvirus 4

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|P89884_M11-01 M11 protein OS=[Viruses] Murid herpesvirus 4 GN=M11 (length=171 residues).
MSHKKSGTYWATLITAFLKTVSKVEELDCVDSAVLVDVSKIITLTQEFRRHYDSVYRADYGPALKNWKRDLSKLFTSLFV
DVINSGRIVGFFDVGRYVCEEVLCPGSWTEDHELLNDCMTHFFIENNLMNHFPLEDIFLAQRKFQTTGFTFLLHALAKVL
PRIYSGNVIYV
© 1998-2018