Dataset for protein vNR13 of organism Meleagrid herpesvirus 1

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|Q9E1F2_vNR13-01 vNR13 protein OS=[Viruses] Meleagrid herpesvirus 1 GN=vNR13 (length=179 residues).
MADSLKEETALLLEDYFQHCCGKEGPPPSPTAAELRRAAAELERRERPFFRSCAPLASGGTQAALSALQSVVSELNSGSG
FNWGRCLATIVLGGSLATALYENGCEEGPSRLAAALAAYLAEEQGEWLREHGGWDGFCRFFARFGPGLGEASQTFPLGLI
VAAAGIGITVLIVVWQFQS
>gnl|bcl2dbpro|Q9E1F2_vNR13-02 vNR13 protein OS=[Viruses] Meleagrid herpesvirus 1 GN=vNR13 (length=162 residues).
MADSLKEETALLLEDYFQHCCGKEGPPPSPTAAELRRAAAELERRERPFFRSCAPLASGGTQAALSALQSVVSELNSGSG
FNWGRCLATIVLGGSLATALYENGCEEGPSRLAAALAAYLAEEQGEWLREHGGWVSTARAGMSGSFGSPVSARSEEHRAR
RW
© 1998-2018