Dataset for protein Unclassified of organism Macaca nemestrina rhadinovirus 2

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A0B5CYR6_uncORF16-01 Putative ORF16 protein OS=[Viruses] Macaca nemestrina rhadinovirus 2 (length=184 residues).
MEAVRAPPPEEENDNSLPDDVYAIEGIFLYCGLGQAEYLHHPVFSPIKEFIRAFLKDSARLYERLLRNIDYRSMRGLNAI
GQGMLQINADGRHNWGRVLAVLGLGAYVVEKVMNDERLLTFAIAVLPVYAYEALESQWFRLHGGWEGLRNYCARILRHRR
NARHMCYGVAAGLLALVALFAMRR
© 1998-2018