Dataset for protein Unclassified of organism Macaca mulatta rhadinovirus 17577

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|Q9WRT6_uncORF16-01 Putative ORF16 protein OS=[Viruses] Macaca mulatta rhadinovirus 17577 (length=187 residues).
MAAVQGPPPPPEEENENSLPVDVYAIEGIFLYCGLGQAEYLHHPVFSPIKEFISAFLKDSARLYERLLRHTDYRSLRGLN
AIGQGMLQINTDGRHNWGRALAVLGLGAYVVDKVKDDERLLTFAIAVLPVYAYEALESQWFRSHGEWEGLRNYCERILRH
RRNARRHMCYGVAAGLLALVALFAIRR
© 1998-2018