Dataset for protein Unclassified of organism Macaca fuscata rhadinovirus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|Q53D42_uncORF16-01 Putative ORF16 protein OS=[Viruses] Macaca fuscata rhadinovirus (length=187 residues).
MAAIQGPPPLPEEENENSLPDDVYAIEGIFLYCGLGQAEYLHHPVFSPIKEFISSFLKDSARLYERLLRHTDYRSLRGLN
AIGQGMLHINTDGRHNWGRALAVLGLGAYVVDKIRDDERLLTFAIAVLPVYAYEALESQWFRSHGGWEGLRNYCERILRH
RRNARRHMCYGVAAGLLALVALFAIRR
© 1998-2018