Dataset for protein Unclassified of organism Macaca arctoides gammaherpesvirus 1

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3G1T4B1_uncBHRF1-01 Putative BamHI-H right reading frame protein OS=[Viruses] Macaca arctoides gammaherpesvirus 1 (length=190 residues).
MAYSTRDVLLALCIRDNHVHGTGGLHPVLELALREAPSSVSSANPLTLHMHGILEQIIAQNQATFVETWDRFLESTDDVD
RDFGRVFAEIFHRGDPSFGRALAWLAWCMHACRTLCSDQNTPYYLVDLSVRGMLEASSGLDGWISQQGGWLALLRGEHPA
SRSSRWTVFLAGLSLTLLVVCSYLFISRRH
© 1998-2019