Dataset for protein Unclassified of organism Lymphocryptovirus Macaca pfe lcl E3

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A0S0DWX8_uncBALF1-01 Putative BALF1 protein OS=[Viruses] Lymphocryptovirus Macaca/pfe-lcl-E3 (length=182 residues).
MQPAKSTDSVFVRTPVEAWVSPSPPDDKVAETSYLLFRAMYAVFTQDETDLPLPALVMCRLLKASLRKHRRMYAELACKT
ADLGGKHAHMQLIISVLRAVYDDHYDYWSRLRVVLCYTVVFAVRNYLDDHDSAAFVMGATAHYLALYRRLWFASLGGLPR
ALRRQFPVTWTVASLSTFLKSL
© 1998-2018