Dataset for protein Unclassified of organism Lepisosteus oculatus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|W5N753_uncvNR13-01 Putative vNR13 protein OS=[Eukaryota] Lepisosteus oculatus (length=531 residues).
MCDQTFLAINFGPCDKCQKTKPLMNIYIKSEPINYCALCVELMATEGLQESETLASLKNESETLKSKLEEERAKLHDVEL
HQVADRVEALGQFVMKTRRTLKGHGNKVLCMDWCKDKRRIVSSSQDGKVIVWDAFTTNKEHAVTMPCTWVMACAYAPSGC
AVACGGLDNKCSVYPLTFDKNENMASKKKSVAMHTNYLSACSFTNSDMQILTASGDGTCALWDVESGQLLQSFHGHAADV
LSLDLAPSETGNTFVSGGCDKKAMVWDLRSGQCIQSFETHESDINSVRYYPSGDAFASGSDDATCRLYDLRADREVAIYS
KESIIFGASSVDFSLSGRLLFAGYNDYTINVWDVLKGTRVSILFGHENRVSTLRVSPDGTAFCSGSWDHTLRKMSCCLRE
QTLILARDYIDLCLGTTRQSPSPNAEAMRSLAKEMEKQYQSKFNSLLHSFIATCGPDPSVNLKKVMEELVGDGILNWGRV
VSLFTFTGLLARQLYAEGASIDCFKRLAETIADYLGGEKREWLIQNEGWVS
© 1998-2018