Dataset for protein herpesviridae of organism Latimeria chalumnae

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|H3ALX7_vNR13-01 vNR13 protein OS=[Eukaryota] Latimeria chalumnae GN=vNR13 (length=178 residues).
MCDSLKEETRLLANDFIQFCLGSGRTAPNPAARVLRRVTAELERQNQALFDSFQGNCGPEAELGSVLKRVAEQLEAEGGL
NWGRVVSLFAFAGCLAKGVQRAQNEECAMGACCGKLAEALVNYLAKERGDWLEENGGWDGFYKFFERSDHYQESTVRNAL
MAAAGFGIAGLAFLLAVR
© 1998-2018