Dataset for protein Unclassified of organism Human herpesvirus 8

[Download (right click)]

2 sequence(s)

>gnl|bcl2dbpro|A0A0N9SCW9_uncORF16-01 Putative ORF16 protein OS=[Viruses] Human herpesvirus 8 (length=175 residues).
MDEDVLPGEVLAIEGIFMACGLNEPEYLYHPLLSPIKLYITGLMRDKESLFEAMLANVRFHSTTGINQLGLSMLQVSGDG
NMNWGRALAILTFGSFVAQKLSNEPHLRDFALAVLPVYAYEAIGPQWFRARGGWRGLKAYCTQVLTRRRGRRMTALLGSI
ALLATILAAVAMTRR
>gnl|bcl2dbpro|A0A0N9SEY2_uncORF16-01 Putative ORF16 protein OS=[Viruses] Human herpesvirus 8 (length=175 residues).
MDEDVLPGEVLAIEGIFMACGLNEPEYLYHPLLNPIKLYITGLMRDKESLFEAMLANVRFHSTTGINQLGLSMLQVSGDG
NMNWGRALAILTFGSFVAQKLSNEPHLRDFALAVLPVYAYEAIGPQWFRARGGWRGLKAYCTQVLTRRRGRRMTALLGSI
ALLATILAAVAMTRR
© 1998-2018