Dataset for protein herpesviridae of organism Human herpesvirus 8 type P

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|F5HGJ3_ORF16-01 ORF16 protein OS=[Viruses] Human herpesvirus 8 type P GN=ORF16 (length=175 residues).
MDEDVLPGEVLAIEGIFMACGLNEPEYLYHPLLSPIKLYITGLMRDKESLFEAMLANVRFHSTTGINQLGLSMLQVSGDG
NMNWGRALAILTFGSFVAQKLSNEPHLRDFALAVLPVYAYEAIGPQWFRARGGWRGLKAYCTQVLTRRRGRRMTALLGSI
ALLATILAAVAMSRR
© 1998-2018