Dataset for protein BALF1 of organism Gorilline gammaherpesvirus 1

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|Q91HI3_BALF1-01 BALF1 protein OS=[Viruses] Gorilline gammaherpesvirus 1 GN=BALF1 (length=182 residues).
MRPAKSTDSVFVRTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTQDETGLPLPAMVLCRLIKASLKKDKKLYAELACKT
ADIGGKHAHVQLIISVLRAVYDDHYDYWSRLRVVLCYTVVFAVRNYLDDHESAAFVLGAIAHYLALYRRLWFARMGGMPR
SLRRQFPVRWALAGLTYFLKSL
© 1998-2018