Dataset for protein Unclassified of organism Gopherus agassizii

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A452I804_uncvNR13-01 Putative vNR13 protein OS=[Eukaryota] Gopherus agassizii (length=146 residues).
AETLRRAASELESRERPFFRACRPLALDERQEPAALLSRVAEQLEAEGGLNWGRVLALVVFAGSLAAALAEQGSREEAGR
LAEVLASYLAEEKREWLEAHGGWDGFCHFFNGHGSQPTDQSSTISSAIMAAAGFGLAGLAVLLAVR
© 1998-2019