Dataset for protein Unclassified of organism Gallus gallus

[Download (right click)]

2 sequence(s)

>gnl|bcl2dbpro|Q804D0_uncvNR13-01 Putative vNR13 protein OS=[Eukaryota] Gallus gallus (length=177 residues).
MPGSLKEETALLLEDYFQHRAGGAALPPSATAAELRRAAAELERRERPFFRSCAPLARAEPREAAALLRKVAAQLEAEGG
LNWGRLLALVVFTGTLAAALAESGCEEGPSRLAAALAAYLAEEQGEWLEEHARWDGFCRFFGRHGSQPADQNSTLSNAIM
AAAGFGIAGLAFLLVVR
>gnl|bcl2dbpro|Q90ZN1_uncvNR13-01 Putative vNR13 protein OS=[Eukaryota] Gallus gallus (length=177 residues).
MPGSLKEETALLLEDYFQHRAGGAALPPSATAAELRRAAAELERRERPFFRSCAPLARAEPREAAALLRKVAAQLEAEGG
LNWGRLLALVVFTGTLAAALAESGCEEGPSRLAAALAAYLAEEQGEWLEEHGGWDGFCRFFGRHGSQPADQNSTLSNAIM
AAAGFGIAGLAFLLVVR
© 1998-2018