Dataset for protein BHRF1 of organism Epstein Barr virus

[Download (right click)] [Alignment] [Repertoires]

34 sequence(s)

>gnl|bcl2dbpro|A0A0B6VHG4_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTENLD
LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQYTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|A0A0C7SXB3_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCFNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|A0A0C7T306_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETHLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|A0A0C7T6R4_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFSETWNRFITHTEHVD
LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|A0A0C7T924_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRKFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|A0A0C7TK05_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNPSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|A0A0C7TNT4_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
LDFNSVFLEIFHRGDPSLGRTLAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|A0A0C7TQI4_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTRDILLALCIRDSRVHGNGALHPVLELAARETPPRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTENLD
LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQYTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIENNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|A0A0C7TTN2_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLHLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|A0A0C7TWM2_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLLPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|A0A0C7TX82_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
LDFNSVFLEIFHRGDPSLGRALAWMAWCMYACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|A0A0C7U1E2_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGTLHPVLELASRETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCYNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|A0A0S2YQS0_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAHSTREILLALCIRDSRVHGNGVLHPVLELAARETPPRVSPEDTVVLRYHVLLEEIIERNSDTFTETWDRFITHTEHLD
LDFNSIFLEIFHRGDPSRGRALAWLAWCMHACRTLCCNQDTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRSFSWTLFLAGLTLSLLVVCSYLFISRGRH
>gnl|bcl2dbpro|A0A0S2YRE8_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
LDFNSVFLEIFHRGDPRLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|A0A0X8YIW3_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRALCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|A0A0X9C4Q9_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFIRHTEHLD
LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|A0A2D1LYW3_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLLPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRRLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|A0A2H4Z4C5_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTDHLD
LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|A0A2H4Z4D6_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTANLD
LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQYTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|A0A2H4Z4D9_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
LDFNSVFVEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFIWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|A0A2H4Z4E3_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNSFITHTEHVD
LDFNSVFVEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|A0A2H4Z4F2_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHLD
LDFNSVFLEIFHRGDPSLGCALTWMAWGMHACWTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|A0A2H4Z4F8_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGILHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
LDFNSVFVEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|A0A2H4Z4H8_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNASLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHLD
LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|A0A2H4Z4I0_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTRDILLALCIRDSRVHGNGALHPVLELAARETPPRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHLD
LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|A0A2H4Z4I4_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGSLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHLD
LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|A0A2H4Z4M5_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGSLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHLD
LDFNSVFFEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|G3CKQ0_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHLD
LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|K9UTF7_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
LDFNSVFVEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|K9UTN7_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|P03182_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|P0C6Z1_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
>gnl|bcl2dbpro|V5KU29_BHRF1-02 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRQ
>gnl|bcl2dbpro|V5KUE2_BHRF1-02 BamHI-H right reading frame protein OS=[Viruses] Epstein-Barr virus GN=BHRF1 (length=191 residues).
MAYSTREILLALCIRDSRVHGNGTLHPVLELASRETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
SRRFSWTLFLAGLTLSLLVICSYLFISRGRH
© 1998-2018