Dataset for protein Unclassified of organism Danio rerio

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|Q8UWD5_uncvNR13-01 Putative vNR13 protein OS=[Eukaryota] Danio rerio (length=176 residues).
MSCWLREQTLLLAEDYISFCSGIQQTPPSESAEAMRYLAKEMEQQHRTKFRSLSQEFLDTCGADPSKCLQSVMRELVGDG
KMNWGRVVSIFTFTGVLASELLSRGENSEGSRRLAETIADYLGGEKQDWLVENGGWEGFCRFFHNARQLNQESSMKTALF
AAAGVGLAGLTFLLVR
© 1998-2018