Dataset for protein Unclassified of organism Cricetid gammaherpesvirus 2

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|E9M5Q5_uncM11-01 Putative M11 protein OS=[Viruses] Cricetid gammaherpesvirus 2 (length=172 residues).
MDNLTEWRSLLKVFLLKSSGCSCQGVSAGLLADVDVLDKLTTDFITKYESVYGKLPLTQSDWVNNITALLFFMLDKINFG
RFIGLFAVGKFVCQELLLSSTTWSMAHDLLFHKLALVLEVKIMPWLTSMGVGTFNELLGRHAGQVVQTRFFYFLKSMFVW
ACMQLLDPWPFT
© 1998-2018