Dataset for protein BHRF1 of organism Cercopithecine herpesvirus 12

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|Q9Q5K8_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Cercopithecine herpesvirus 12 GN=BHRF1 (length=190 residues).
MAYSTRDLLLALCMRDGHVYGGDGLHPVLELTARESPFSVSPGDPLVLRLHALLEQIIVQNEDAFAETLVTFLLNTEDLD
LDFSRVFAEIFHNEDPTLGRGLAWLAWCMHACRTLCGDTNCPYYVVDLAVRGMLEASEGLDGWIGQHGGWPAVLRGNPSG
TRSSRWTIVFTGLTLSLLVVCSYIFISRRH
>gnl|bcl2dbpro|Q9WGB5_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Cercopithecine herpesvirus 12 GN=BHRF1 (length=190 residues).
MAYSTRDLLLALCMRDGHVYGGDGLHPVLELTARESPFSVSPGDPLVLRLHALLEQIIVQNEDAFAETLDRFLLNTEDLD
LDFSRVFAEIFHNEDPTLGRGLAWLAWCMHACRTLCGDTNCPYYVVDLAVRGMLEASEGLDGWIGQHGGWPAVLRGNPSG
TRSSRWTIVFTGLTLSLLVVCSYIFISRRH
© 1998-2018