Dataset for protein BALF1 of organism Cercopithecine herpesvirus 12

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|Q99F66_BALF1-01 BALF1 protein OS=[Viruses] Cercopithecine herpesvirus 12 GN=BALF1 (length=182 residues).
MKAAKSTDSVFVRTPVEAWVSPSPPDDKVAETSYLLFRAMYAVFTQDETDLPTPAQVLCRLIKASLRKDKKLYAELACKT
ADIGGKHAHVQLIISILRAVYDDHYDYWSRLRVVLCYAVVFAVRNYLDDHESAAFVLGATAHYLALYRRVWFARIGGLPR
SLRRQFPVTWAIASLSDFLKSL
© 1998-2018