Dataset for protein Unclassified of organism Callitrichine gammaherpesvirus 3

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|Q993L0_uncBALF1-01 Putative BALF1 protein OS=[Viruses] Callitrichine gammaherpesvirus 3 (length=173 residues).
MTDDVFQDNAPNLGAEDEMDRGVLLLTRVMIAAYLDDPGKGLGTEERLFLRLIKRLMKKEEKRFADIVNSGSAPTTLHGH
IKRLMTFTRAIYEDHMDNWFRVRALTSLAVAYARRNIPGDSENAGLLLVGFAEFLCLYRRAWLSRLGGIRVGLRRAFPLT
WMRMRVGESCYKQ
© 1998-2018