Dataset for protein Unclassified of organism Bovine gammaherpesvirus 6

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A060CXQ6_uncA9-01 Putative A9 protein OS=[Viruses] Bovine gammaherpesvirus 6 (length=173 residues).
MQFKDIEAGRVEEDRTEETDEAGCSDIFIHQLKLALIKGGIKYIYANWIIDTAKEKSAQLIEKFDSLSKDVEFSTPDDLK
LVLNSMFEDGVNLGRVTVFFAYVIYLHLKLEDCSFPDAHYTVIKETMDTYIIPWLQTNISSIKEMSSSIANVFATLVAPI
ALGIASMFLFQKG
© 1998-2018