Dataset for protein Unclassified of organism Ateline herpesvirus 3

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|Q9YTQ0_uncVBCL2-01 Putative V-BCL-2 protein OS=[Viruses] Ateline herpesvirus 3 (length=174 residues).
MYIHSSSCYDISKKMSSITFQKTIESILNECQECHSQSDSIVRAIHSVIQQYNKFEDLMPDFSICAHDRIKFVGEAIMLT
TKHNTNWGKVVAMISFSVAALQTIDEDYRRVATSTLSSYIAKSVGVNWFIDHGGKKGLVEFCDTILSKSNVTFSVFLLPA
ILTVIILIGTLLIK
© 1998-2018