Dataset for protein Unclassified of organism Astyanax mexicanus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|W5LAB6_uncvNR13-01 Putative vNR13 protein OS=[Eukaryota] Astyanax mexicanus (length=176 residues).
MSCWLRKETLALAEDYIRFCTGDQRTPPSESAEAMRRLAKEMERQHHSKFHSLSQSFLTACGADPSACLRSVMAVLVEDG
KLNWGRVVSLFTFTGVLATELFSRGDGPECCSRLAETIADYLGAENKEWLLENEGWEGFCKFVRRAGHLGQDSSMKTALF
AAAGVGIAGLTFLLVR
© 1998-2019