Dataset for protein herpesviridae of organism Alcelaphine herpesvirus 1

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|O36423_A9-01 A9 protein OS=[Viruses] Alcelaphine herpesvirus 1 GN=A9 (length=168 residues).
MKMLGEPEFKENILYYSFLNELFLILIRNGFSCSHAKLILDETRKRGLECSGQFEVISNSVEAPEPESLERIAKTLFTPR
PHWGRLVAFLAYLAYLQKNSTEKLFWNDHLKKLKQIVKCHIVPWTLGPRDPKPKQRPFDKLPSAFYFLTAAASCLTLLLL
YFRTTQTK
© 1998-2018