Dataset for protein Unclassified of organism Alcelaphine gammaherpesvirus 2

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A068AAN3_uncA9-01 Putative A9 protein OS=[Viruses] Alcelaphine gammaherpesvirus 2 (length=165 residues).
MGEPEFQDNVLYYLFLDELNFVLIRNGFSCSHAKLIMDETRKRVTDYSEQFEVISKAVEPPEPESLGRIAASLLTPNPNW
GRLVAFFAYLAYLQRNSSHKVFTKNHIKQLKKIVKKHVVPWNSDLKGSKAKLPAPRQPLKSTLLLTAAASCLTFFLIYFR
SIRAK
© 1998-2018