Dataset for protein Unclassified of organism all

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A0C5AZX0_uncLMW5HL-01 Putative LMW5-HL protein OS=[Viruses] African swine fever virus (length=179 residues).
MEGEELIYHNIINEILVGYVKYYMNDISEHELSPYQQQIKKILTYYDDCLNKQVTITFSLTSAQEIKTQFTEVVTELFKD
LINWGRICGFIVFSARMAKYCKDANNHLESTVITTAYNFMKHNLLPWMISHGGQEEFLAFSLHSDIYSVIFNIKYFLSKF
CNHMFLKSCVHLLRNCNLI
© 1998-2018