Dataset for protein LMW5-HL of organism African swine fever virus E75

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|D4I5M9_LMW5HL-01 LMW5-HL protein OS=[Viruses] African swine fever virus E75 GN=LMW5-HL (length=179 residues).
MEGEELIYHNIINEILVGYIKYYINDISEHELSPYQQQIKKILTYYDECLNKQVTITFSLTSVQEIKTQFTGVVTELFKD
LINWGRICGFIVFSAKMAKYCKDANNHLESTVITTAYNFMKHNLLPWMISHGGQEEFLAFSLHSDMYSVIFNIKYFLSKF
CNHMFFRSCVQLLRNCNLI
© 1998-2018