Dataset for protein adenoviridae of organism unclassified Simian adenoviruses

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|Q8B6X5_E1B19K-01 E1B19K protein OS=[Viruses] unclassified Simian adenoviruses GN=E1B19K (length=183 residues).
MDLRTALQTFESTRRLLELCSNRTSFLWRWLFGTPLSRLVRQVKLEYEKDFERILDQCPGVFESLELGYHKVFEDKIVKE
LDFSSPGRAVAAVAFASYLLDRWNTRTHLSPGYQMDYIRLNLWKFWLRRRVYNYSRGLPQLGPVAPLVRQGSQQEEQQQQ
RQEEQQVQEEGEMRSGLDPPTEN
© 1998-2018