Dataset for protein Unclassified of organism all

[Download (right click)]

33 sequence(s)

>gnl|bcl2dbpro|G1FQL6_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Bat adenovirus 2 (length=180 residues).
MDLLRACSTYSAFKYMMKGSTYNSGWVRRWCFPGLSEVVGTLAETHSYRFWNMMPRRHLYWDLVRRGYCTSFFEIMFRKA
DLSNRGRVLAYLAFVSFLLRNWPQDSVVPEADRLDLICIPAWTRMQSWQQTVTLMQEIEEIQQGTGAEECTDAEQAFVEE
EEEQGGGSSPDPLTEGSMQP
>gnl|bcl2dbpro|D3X7A9_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Bat adenovirus TJM (length=182 residues).
MDPLALCADYSTFRFIIRGSLCGSGWVRRFCFPALANVLAEVAEEYEEGYWRAFPPEDYNWDLLRRGYTFAAFVDLFSTV
DLSNGGRVLSFLGFLSFILRYWPSDSVVPAADRLDFICIPAWTKMQLWSQSLRFMEELESAMAARREGMGSDPAPAPAEE
PTQPVRLRAITRSTQTDLDHQD
>gnl|bcl2dbpro|A0A161DIM0_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Bat mastadenovirus WIV10 (length=317 residues).
MDYLKFLSNYAVLKRIVRDSSERTGPWRRYFFCGPLVNFVHKIKLDHKEEFEQCLDAEGIFLDRLRSGDLSVYNTQVVLH
LHLENPGRVAASIAFVAWLLDQWDLQNQFSPDFSLDALCIPLWKLIRAEVCNRDLSAAARVFQEELEREGLIDPPETLAE
ESPERADNEEGDLHLAEPAVVQETGSEEEDEEMPPLEESEEESESLGEEELEEVETEGDSELEVVFASENDVLSPTPDLL
RQGAASGLSSSSEEVCFSPLSGVAPLASSDSSCSEPEEEERVVPPNGGRAIRVSVIVHAPAQGTGGAQGQSLSGGRM
>gnl|bcl2dbpro|A0A163HKI5_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Bat mastadenovirus WIV11 (length=317 residues).
MDYLKFLSNYAVLKRIVRDSSERTGPWRRYFFCGPLVNFVHKIKLDHKEEFEQCLDAEGIFLDRLRSGDLSVYNTQVVLH
LHLENPGRVAASIAFVAWLLDQWDLQNQFSPDFSLDALCIPLWKLIRAEVCNRDLSAAARVFQEELEREGLIDPPETLAE
ESPERADNEEGDLHLAEPAVVQETGSEEEDEEMPPLEESEEESESLGEEELEEVETEGDSELEVVFASENEVLSPTPDLL
RQGAASGLSSSSEEVCFSPLSGVAPLASSDSSCSEPEGEERVAPPSGGRAIRVSVIVHAPAQGTGGAQGQSLSGGRM
>gnl|bcl2dbpro|A0A1B0UI04_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Bat mastadenovirus WIV12 (length=138 residues).
MKKTYKDVLRSYNTVRDILAGASDKTWFFYRKLFCHRWVYSVHRIKIDYKKDFFNILELWPQILQFLEIGNTYYFEKIVV
PELIFDTFERTIVSLAFVAFLIDRWKEQGIFSWDYIIETAALQVWQAFMRMLWRENLL
>gnl|bcl2dbpro|A0A1B0UHW6_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Bat mastadenovirus WIV13 (length=139 residues).
MEANYIQYLKSYSDFRDLLNGASARTGFLYRWLFCDKLTYWVYRVKIENRVIFEEIVKDFPETFFESLEAGYTCDFEDSI
VPQLEFLSLGHTLSSLAFVVFLIDYWKENSVFSWDFIIESFGLITWRAIIMAFTREKLL
>gnl|bcl2dbpro|A0A1X9RIQ7_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Bat mastadenovirus WIV17 (length=168 residues).
MERAADIPFSFQGLKHILTLTYKASKSSWFWRKFCTPSLILAILEAKESYAEDFDSFLTTDFCLQSFLDTLDWQSLEKSL
IPNLDFSSSGRAIASLAFLSSIIDRLEFSTIFTSSYLIENFAFAVWRWAITLTKGSKTSEQLKMSKMKTPELTEKQEEAL
TELMKSWD
>gnl|bcl2dbpro|A0A1X9RIT9_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Bat mastadenovirus WIV18 (length=168 residues).
MERAIDIPFSFQGLRHILTLSYKASKSSWFWRKFCTPSLILAIVDAKESYAEDFNSFLTTDFCLQSFLDTLDWPSLEKSL
IPNLDFSSPGRAIASLAFLSSIIDRLEFATVFTPSYLIENFSFAVWRWAITLTKESRTSEQSKMLKMKTPDLTEKQEEAL
MELIKSWD
>gnl|bcl2dbpro|A0A163HHM5_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Bat mastadenovirus WIV9 (length=317 residues).
MDYLKFLTNYAVLKRIIRDSSERTGPWRRYFFCGPLANFIHKIKEENKELFAQCLDSEGQFLELLRSGDLALYNTKVVPA
LQFENPGRVASSLAFVVWLLDQWDLQNQFSPEFSLEALCIPVWKIIKQEVAQRELGTAARVFQQELEREGLIDPPGSMVG
ETPEREDTEEGELHLAEPAVIQETESEGEEEEMPPLEESESEEESMGEEELEEVETEEDSELEVVFAAENEVLSPTPDLL
RQAAVSGLSSSSEEQCFSPLSGVAPLASSDSSCSEPEEEERVVPPSGGRAIRVSVIVHAPAQGTGGAQGQSSSGGRM
>gnl|bcl2dbpro|A0A1J0FAP3_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Bat mastadenovirus (length=181 residues).
MDLFSMCADYSSFRYILRGSLCGSSWVRKWCFPALADAITGIADDYEDGYWRAFPPDDINWNLLRRGYTFAAFTDLFSSV
DLGNAGRFMSFLGFLNFILRNWPSDSVVLSADRLDLICVPAWTKIMLWSQTMRQMEELQLLEMAAAQAAAAARGARAEET
SETTPLLQSTSTQTEQLETDL
>gnl|bcl2dbpro|A0A0M4LS43_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Bottlenose dolphin adenovirus 1 (length=219 residues).
MDLKFLELLGKRDYLRRLLENASLRTSSFYRFIFCDSLTKLVYTAWEQYHQNFDEILPQGSSFWVVLNSGRIGALHGALQ
SVDFSSNGRGIASLAFLVNILNHLDASGAYSKGFTSEILSLLVWPKIRFVLNYKKIAALEAEVYPSMSTSRLPPITRMVP
MNRIRDQEQEANVEQPEDEVPAQNLFNPRTPPLSSSSSQSSQNSLDSESESDEGWLAMD
>gnl|bcl2dbpro|A0A1X7MN46_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Bottlenose dolphin adenovirus 1 (length=183 residues).
MDLKFLLALDNKKYLEKLLVLASKRTSFLYRTFFADDLIKLVHSASNDYKSNFEDVLPAGCSFWILLGSGKIGTLQGLLH
SVDFSSNGRGVASLAFFVHILNCLDEFLFFSKTFNLEVLVNTLWPTIHCALNQQRVNVLQGAMNQLTETPVPSIESLISP
ESSGSENESDPVAELEEGSLETE
>gnl|bcl2dbpro|Q9EEG2_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Bovine adenovirus 2 (length=159 residues).
MDLSLQLCEQLSSLPQLRRVIYYATNRASWWSRTFFGGRLANLVYTIKVEEAESLQELFNEDEGFWQMFGSGRTLGYESK
IVPWLDFSTPGRATASLSLLAYIVDCLDKQSELSSDFILDAVCGPVCYKLKMLLSLQKLQGHLSGSSVGSTCHSREETD
>gnl|bcl2dbpro|G9HQG8_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Bovine adenovirus B serotype 3 (length=157 residues).
MDHLSFLLDLKLLRSIVAGASNRTGVWKRRLWLGRLTQLVHDTCVENESIFLNSLPGNEAFLRLLRSGYFEVFDVFVVPE
LHLDTPGRVVAALALLVFILNDLDANSASSGFDPGFLVDRLCVPLWLKARAFKITQSSRSTSQPSSSPDKTTQTTSQ
>gnl|bcl2dbpro|Q64843_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Bovine adenovirus B serotype 3 (length=157 residues).
MDHLSVLLDLKLLRSIVAGASNRTGVWKRRLWLGRLTQLVHDTCVENESIFLNSLPGNEAFLRLLRSGYFEVFDVFVVPE
LHLDTPGRVVAALALLVFILNDLDANSASSGFDSGFLVDRLCVPLWLKARAFKITQSSRSTSQPSSSPDKTTQTTSQ
>gnl|bcl2dbpro|A0A059XJ33_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] California sea lion adenovirus 1 (length=147 residues).
MEQLKDYSFFKEVVEHASLRTGNLYRFFFSSSLAKVVFQVYLEKVGEFDRLDSTASALLALSQGNNFLFEKLIIPELPFY
SFGHILASLAFCSFCVNKADISATVSSGFILDAVCRPAWQKFMMSHNMMENQTGSSEFSLEEALTDN
>gnl|bcl2dbpro|Q65942_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Canine adenovirus serotype 1 (length=169 residues).
MDPLKICENYLTFRSIIKGSTFSPGVFRRWRFHALADVVGNIVEREEGRFWEIVPETHTLWALFRGGFTVAPFTEILTSL
QLENRGRQLAFLAFLSFLLRNWPSDSVVSEDARLDLVCAPAWSRIQIWSQAARLINDLPESVFEGQGSVVEEECGEEHLA
RDSDDPLFD
>gnl|bcl2dbpro|Q96678_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Canine adenovirus serotype 1 (length=169 residues).
MDPLKICENYLTFRSIIKGSTFSPGVFRRWRFHALADVVGNIVEREEGRFWEIVPETHTLWALFRGGFTVAPFTEILTSL
QLENRGRQLAFLAFLSFLLRNWPSDSVVSEDARLDLVCAPAWSRIQIWSQAARLINDLPESVFEGQGSVVEEECGEEHLA
RDSDDPFFD
>gnl|bcl2dbpro|P14265_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Canine adenovirus serotype 2 (length=169 residues).
MDPLKICENYLTFRAIIRGSTLSPGFFRRWCFPALADVVGNIVEQEEGRFWQILPENHAFWGLLRRGFTVASFTEIITAA
QLENRGRQLAFLAFISFLLRNWPSDSVVPEADRLDLVCAPAWSRMQIWSQTARLINDLQDSVLEEQGSAEEEECEEALLA
GDSDDPLFG
>gnl|bcl2dbpro|A0A1J0MUK8_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Canine mastadenovirus A (length=169 residues).
MDPLKICENYLTFRSIIKGSTFSPGVFRRWRFHALADVVGNIVEREEGRFWEIVPETHTLWALFRGGFTVAPFTEILTSL
QLENRGRQLAFLAFLSFLLRNWPSDSVVSEDARLDLVCAPAWSRIQIWSQAARLINDLPESVFEGQGSVVEEECGEEHLA
RDSDDPFFD
>gnl|bcl2dbpro|A0A1Y0B6F3_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Cervid adenovirus 1 (length=157 residues).
MDHLDILIDLRLLRSVIAGASNRTGAWKRRLWLGRLTQLVHNICSENQESFLNSLPGNANFLRLLRTGYFEVYDVFVVPE
LHLDSPGRVVAALALLVFILNDLDAHSAASGFDSGFLIDRLCVPLWLKARAYKITQSSRTNLQPSSSPDKTTPTSSQ
>gnl|bcl2dbpro|A0A1B0XB89_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Equine adenovirus A serotype 1 (length=261 residues).
MQQRTRKLRQRMRRPVTMTRRGAPGAWRNKRSPWTCLSDTPVKSENKKQICGHATGVVVLLISACLVWLLHLLFRQGLGE
VGMEVLNYCRNYYEFRRMIKGTTYSLGWVRRWLFSPLSDVVCMVAEKNELAYWRALPPSHFYWDMLKRGHAFFGKEDLFA
CVDLSTGGRVLASLGFLAFVLRHWPRDSVVPFEQRLDLICAPAWTRMQMWIQMEESRALEQQQPPEETIEEEEETSDAEE
TGSMEGLEDSDEEDLESLVVR
>gnl|bcl2dbpro|G5CZ72_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Equine adenovirus A serotype 1 (length=179 residues).
MEVLNYCRNYYEFRRMIKGTTYSLGWVRRWLFSPLSDVVCMVAEKNELAYWRALPPSHFYWDMLKRGHAFFGKEDLFACV
DLSTGGRVLASLGFLAFVLRHWPRDSVVPFEQRLDLICAPAWTRMQMWIQMEESRALEQQQPPEETIEEEEETSDAEETG
SMEGLEDSDEEDLESLVVR
>gnl|bcl2dbpro|A0A0K1DBT8_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Equine adenovirus B serotype 2 (length=138 residues).
MDLMKLLDFKEFKRCVYLASNRCRWWEKIFCTRFIKFVRQIKKENFLEFAELILCNTAFSSCLKSGQVSLFHNTVLCELD
FSNPGRVVTNLAFLSYLIDMWDQVDVFSHEFILESVCFPAWQRFNQTQPKGVLKSTEV
>gnl|bcl2dbpro|A0A219PC56_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Human adenovirus B serotype 7 (length=79 residues).
MDKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILNYWPVQPLGVAGILRHPPTMPAVLQEEQQEDNPRAGLDPPVEE
>gnl|bcl2dbpro|E7CH29_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Murine adenovirus 2 (length=333 residues).
MDLLKHLSEYKVLRDLVLESSSFKPWWWRRRGLSNLVRETIEKFRTEYEEVLGQVFFTRLNHQDFFLYHYVIREELDLST
PGHQISGISFVVYVLERWALLEQRFGRDYLVDSLVFPLYQRVRSELRWQSRQVLKPVRRFRRSQALPAEQRQSMPFPFQG
DRPTEPLLPSFRLSRSSPPSPNRPQSPLPALVVNQSSRVPPPSNATAAAPGCPPPPTVMIPTSKSLRPRSCPSGAIFTSS
SIDPNPSQRTSPPRPPPKLYQHQYQNLMLSETTSEMASLTVSSPTPPLPPMPPTETPVEKARRGSSDSLSSEREGSYRKV
PGTPARCRRALQL
>gnl|bcl2dbpro|P12535_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Murine adenovirus A serotype 1 (length=175 residues).
MLPVYPFLAPVFDTFESTRALFLEATLSLQEPWWFRLLSFFRSPRYTGLADVVRAIACEREADFTAITPSSLIEDIAEGR
FVMLVGLMEYLRFDTAGQGIVSFAFLSYLIDRVTKQSPLAHFTVVEVVSLVVWRTVKLSRRRERRWVSQLSTLAEEDEDE
EGTTLTTEAEQESSA
>gnl|bcl2dbpro|Q994F2_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Porcine adenovirus 5 (length=163 residues).
MELELSLKLCKTLCDFKNLTRVVYYASDRPGWLSRYFFGGRLAQLVYKAKVDYHQTLTELFEDDQSFWCLLESGRTLGFE
AKVVPWLDFSSTGRVVSSLSLLAYLVDHLDCHTDFSKDYNLEVICAPVCCRLKTLVEIQKLRFRQEETMREALQEDQEAK
ILS
>gnl|bcl2dbpro|Q9WA49_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Porcine adenovirus A serotype 3 (length=202 residues).
MDYQLLAKLTNVNYLRKVIVQGSQNCPWWKKIFSDRFIKVVAEARRQYGQELIEIFVEGERGFGPEFLREGGLYEEAVLK
ELDFSTLGRTVASVALVCFIFEKLQKHSGWTDEGILSLLVPPLCSLLEARMMAEQVRQGLCIIRMPSAEREMLLPSGSSG
SGSGAGMRDQVVPKRPREQEEEEEDEDGMEASGRRLEGPDLV
>gnl|bcl2dbpro|A0A0K0MGC6_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Skunk adenovirus PB1 (length=182 residues).
MDILQLCSSYSQFRGIIRGTTYRAGWVRRWCFHPLTDIVANLAEDFDTRYWLALPLGHPYWELLKRGYTFAGNPDLFGGV
DLSTRGRALAFLGFLTFILRNWPPDSVVPSEARIDLVCVPAWTKIQMWTQTLQLLEEMQTARAMPEEEEEGLTSPSDEEV
ASDSTDQPDPHSDEDPFPPETE
>gnl|bcl2dbpro|A0A240FBF7_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Squirrel adenovirus 1 (length=143 residues).
MEIAPFRHLSYLRRILKCASNRASWFELLFMDKFTSLVRQVKIEKSAELQEMLESCSFLDKPVIEMLKLGYTVGLRYIVN
AEVDVSSPGRLVASMAFLAHVMDVWEKNSDFLPDFILDSVAITLWQMINFRLKAMELGEEEGE
>gnl|bcl2dbpro|P04886_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Tree shrew adenovirus serotype 1 (length=137 residues).
MDFLKPFCQYKVLKSVVVGASNQSSVVSRFFGPKITKLIYSTKVSNRDQFLDSLPRGYLDGLASGDFSKIDLLVEQLDFT
SAGRLTASLSLLVLVVEEWSARSCVSFDILTELLLVPAWRKIIATAWKGRAPPSADV
>gnl|bcl2dbpro|Q77M91_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Tree shrew adenovirus serotype 1 (length=137 residues).
MDFLKPFCQYKVLKSVVVGASNQSSVVSRFFGPKITKLIYSTKVSNRDQFLDSLPRGYLDGLASGDFSKIDLLVEQLDFT
SAGRLTASLSLLVLVVEEWSARSCVSFDILTELLLVPAWRKIIATAWKGRAPPSADV
© 1998-2018