Dataset for protein Unclassified of organism Tree shrew adenovirus serotype 1

[Download (right click)]

3 sequence(s)

>gnl|bcl2dbpro|A0A2U9AG74_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Tree shrew adenovirus serotype 1 (length=137 residues).
MDFLQPFCQYKVLKSVVVGASNQSSVLSRFFGPKITKLIYSTKVSNRDQFLDSLPRGYLDGLASGDFSKIDLLVEQLDFT
SAGRLTASLSLLVLVVEEWSARSCVSFDILTELLLVPAWRKIIATAWERRAQPSADV
>gnl|bcl2dbpro|P04886_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Tree shrew adenovirus serotype 1 (length=137 residues).
MDFLKPFCQYKVLKSVVVGASNQSSVVSRFFGPKITKLIYSTKVSNRDQFLDSLPRGYLDGLASGDFSKIDLLVEQLDFT
SAGRLTASLSLLVLVVEEWSARSCVSFDILTELLLVPAWRKIIATAWKGRAPPSADV
>gnl|bcl2dbpro|Q77M91_uncE1B19K-01 Putative E1B19K protein OS=[Viruses] Tree shrew adenovirus serotype 1 (length=137 residues).
MDFLKPFCQYKVLKSVVVGASNQSSVVSRFFGPKITKLIYSTKVSNRDQFLDSLPRGYLDGLASGDFSKIDLLVEQLDFT
SAGRLTASLSLLVLVVEEWSARSCVSFDILTELLLVPAWRKIIATAWKGRAPPSADV
© 1998-2018